Recombinant Human AGPAT4 Protein, GST-tagged
Cat.No. : | AGPAT4-432H |
Product Overview : | Human AGPAT4 full-length ORF ( NP_064518.1, 1 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 70.4 kDa |
AA Sequence : | MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGPAT4 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [ Homo sapiens ] |
Official Symbol | AGPAT4 |
Synonyms | AGPAT4; 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta); 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; dJ473J16.2; LPAAT delta; 1-AGPAT 4; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; lysophosphatidic acid acyltransferase-delta (LPAAT-delta); 1-AGPAT4; LPAAT-delta; RP3-473J16.2; |
Gene ID | 56895 |
mRNA Refseq | NM_020133 |
Protein Refseq | NP_064518 |
MIM | 614795 |
UniProt ID | Q9NRZ5 |
◆ Recombinant Proteins | ||
AGPAT4-1048H | Recombinant Human AGPAT4 Full Length Transmembrane protein, His-tagged | +Inquiry |
AGPAT4-1420M | Recombinant Mouse AGPAT4 Protein | +Inquiry |
RFL32446MF | Recombinant Full Length Macaca Fascicularis 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Delta(Agpat4) Protein, His-Tagged | +Inquiry |
AGPAT4-12236Z | Recombinant Zebrafish AGPAT4 | +Inquiry |
AGPAT4-284C | Recombinant Cynomolgus AGPAT4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT4-8975HCL | Recombinant Human AGPAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGPAT4 Products
Required fields are marked with *
My Review for All AGPAT4 Products
Required fields are marked with *
0
Inquiry Basket