Recombinant Human AGPAT4 Protein, GST-tagged
| Cat.No. : | AGPAT4-432H |
| Product Overview : | Human AGPAT4 full-length ORF ( NP_064518.1, 1 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 70.4 kDa |
| AA Sequence : | MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AGPAT4 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [ Homo sapiens ] |
| Official Symbol | AGPAT4 |
| Synonyms | AGPAT4; 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta); 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; dJ473J16.2; LPAAT delta; 1-AGPAT 4; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; lysophosphatidic acid acyltransferase-delta (LPAAT-delta); 1-AGPAT4; LPAAT-delta; RP3-473J16.2; |
| Gene ID | 56895 |
| mRNA Refseq | NM_020133 |
| Protein Refseq | NP_064518 |
| MIM | 614795 |
| UniProt ID | Q9NRZ5 |
| ◆ Recombinant Proteins | ||
| RFL32446MF | Recombinant Full Length Macaca Fascicularis 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Delta(Agpat4) Protein, His-Tagged | +Inquiry |
| AGPAT4-34C | Recombinant Cynomolgus Monkey AGPAT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGPAT4-12236Z | Recombinant Zebrafish AGPAT4 | +Inquiry |
| AGPAT4-1420M | Recombinant Mouse AGPAT4 Protein | +Inquiry |
| AGPAT4-561R | Recombinant Rat AGPAT4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGPAT4-8975HCL | Recombinant Human AGPAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT4 Products
Required fields are marked with *
My Review for All AGPAT4 Products
Required fields are marked with *



