Recombinant Human AGR3, His-tagged
Cat.No. : | AGR3-26657TH |
Product Overview : | Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 145 amino acids |
Description : | Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene. |
Conjugation : | HIS |
Molecular Weight : | 19.500kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL |
Sequence Similarities : | Belongs to the AGR family. |
Gene Name | AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | AGR3 |
Synonyms | AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18; |
Gene ID | 155465 |
mRNA Refseq | NM_176813 |
Protein Refseq | NP_789783 |
MIM | 609482 |
Uniprot ID | Q8TD06 |
Chromosome Location | 7p21.1 |
Function | alpha-dystroglycan binding; |
◆ Recombinant Proteins | ||
AGR3-172H | Recombinant Human AGR3 Protein, GST-tagged | +Inquiry |
AGR3-26657TH | Recombinant Human AGR3, His-tagged | +Inquiry |
AGR3-0027H | Recombinant Human AGR3 Protein (Ile22-Leu166), C-His-tagged | +Inquiry |
Agr3-1561M | Recombinant Mouse Agr3 Protein, Myc/DDK-tagged | +Inquiry |
AGR3-395M | Recombinant Mouse AGR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGR3-8971HCL | Recombinant Human AGR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGR3 Products
Required fields are marked with *
My Review for All AGR3 Products
Required fields are marked with *
0
Inquiry Basket