Recombinant Human AGR3, His-tagged
| Cat.No. : | AGR3-26657TH |
| Product Overview : | Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 145 amino acids |
| Description : | Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene. |
| Conjugation : | HIS |
| Molecular Weight : | 19.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL |
| Sequence Similarities : | Belongs to the AGR family. |
| Gene Name | AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ] |
| Official Symbol | AGR3 |
| Synonyms | AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18; |
| Gene ID | 155465 |
| mRNA Refseq | NM_176813 |
| Protein Refseq | NP_789783 |
| MIM | 609482 |
| Uniprot ID | Q8TD06 |
| Chromosome Location | 7p21.1 |
| Function | alpha-dystroglycan binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGR3 Products
Required fields are marked with *
My Review for All AGR3 Products
Required fields are marked with *
