Recombinant Human AGR3, His-tagged

Cat.No. : AGR3-26657TH
Product Overview : Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 145 amino acids
Description : Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene.
Conjugation : HIS
Molecular Weight : 19.500kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Sequence Similarities : Belongs to the AGR family.
Gene Name AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol AGR3
Synonyms AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18;
Gene ID 155465
mRNA Refseq NM_176813
Protein Refseq NP_789783
MIM 609482
Uniprot ID Q8TD06
Chromosome Location 7p21.1
Function alpha-dystroglycan binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGR3 Products

Required fields are marked with *

My Review for All AGR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon