"AGRP" Related Products

Expand
Expand

Recombinant Human AGRP Protein (21-132 aa), His-SUMO-tagged

Cat.No.: AGRP-311H
Product Overview: Recombinant Human AGRP Protein (21-132 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
Description: Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.
Source: E. coli
Species: Human
Tag : His-SUMO
Form: Tris-based buffer, 50% glycerol
Molecular Mass: 28.5 kDa
Protein length: 21-132 aa
AA Sequence: AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name: AGRP agouti related protein homolog (mouse) [ Homo sapiens ]
Official Symbol: AGRP
Synonyms: AGRP; Agrt; ART; ASIP2; AGRT;
Gene ID: 181
mRNA Refseq: NM_001138
Protein Refseq: NP_001129
MIM: 602311
UniProt ID: O00253

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.