Recombinant Human AGRP Protein (21-132 aa), His-SUMO-tagged
Cat.No. : | AGRP-311H |
Product Overview : | Recombinant Human AGRP Protein (21-132 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-132 aa |
Description : | Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 28.5 kDa |
AA Sequence : | AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | AGRP agouti related protein homolog (mouse) [ Homo sapiens ] |
Official Symbol | AGRP |
Synonyms | AGRP; Agrt; ART; ASIP2; AGRT; |
Gene ID | 181 |
mRNA Refseq | NM_001138 |
Protein Refseq | NP_001129 |
MIM | 602311 |
UniProt ID | O00253 |
◆ Recombinant Proteins | ||
Agrp-6859M | Recombinant Mouse AGRP protein, His-tagged | +Inquiry |
Agrp-588M | Active Recombinant Mouse Agrp | +Inquiry |
AGRP-535H | Recombinant Human AGRP Protein, MYC/DDK-tagged | +Inquiry |
AGRP-814M | Recombinant Mouse AGRP Protein (Ser82-Thr131), HlgG1 Fc-tagged | +Inquiry |
AGRP-191H | Recombinant Human AGRP protein(Met1-Thr132), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGRP-1142MCL | Recombinant Mouse AGRP cell lysate | +Inquiry |
AGRP-2471HCL | Recombinant Human AGRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGRP Products
Required fields are marked with *
My Review for All AGRP Products
Required fields are marked with *
0
Inquiry Basket