Recombinant Human AGT protein, His-SUMO-tagged
| Cat.No. : | AGT-2493H |
| Product Overview : | Recombinant Human AGT protein(P01019)(44-427aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 44-427aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.9 kDa |
| AA Sequence : | VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | AGT angiotensinogen (serpin peptidase inhibitor, clade A, member 8) [ Homo sapiens ] |
| Official Symbol | AGT |
| Synonyms | AGT; angiotensinogen (serpin peptidase inhibitor, clade A, member 8); SERPINA8; angiotensinogen; alpha 1 antiproteinase; antitrypsin; serpin A8; angiotensin I; angiotensin II; pre-angiotensinogen; alpha-1 antiproteinase, antitrypsin; serine (or cysteine) proteinase inhibitor; ANHU; |
| Gene ID | 183 |
| mRNA Refseq | NM_000029 |
| Protein Refseq | NP_000020 |
| UniProt ID | P01019 |
| ◆ Recombinant Proteins | ||
| Agt-554M | Recombinant Mouse Agt Protein, MYC/DDK-tagged | +Inquiry |
| AGT-572H | Recombinant Human AGT Protein, His-tagged | +Inquiry |
| AGT-293H | Recombinant Human AGT Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGT-221R | Recombinant Rat AGT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Agt-1159R | Recombinant Rat Agt Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| AGT-152H | Native Human Angiotensinogen | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGT-2575HCL | Recombinant Human AGT cell lysate | +Inquiry |
| AGT-1842MCL | Recombinant Mouse AGT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGT Products
Required fields are marked with *
My Review for All AGT Products
Required fields are marked with *



