Recombinant Human AGTPBP1 Protein, GST-tagged
Cat.No. : | AGTPBP1-445H |
Product Overview : | Human AGTPBP1 partial ORF ( NP_056054, 1087 a.a. - 1186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM, Jul 2002] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGTPBP1 ATP/GTP binding protein 1 [ Homo sapiens ] |
Official Symbol | AGTPBP1 |
Synonyms | AGTPBP1; ATP/GTP binding protein 1; cytosolic carboxypeptidase 1; carboxypeptidase tubulin; KIAA1035; Nna1; soluble carboxypeptidase; tubulinyl Tyr carboxypeptidase; tyrosine carboxypeptidase; carboxypeptidase-tubulin; ATP/GTP-binding protein 1; tubulinyl-Tyr carboxypeptidase; nervous system nuclear protein induced by axotomy protein 1 homolog; CCP1; NNA1; DKFZp686M20191; |
Gene ID | 23287 |
mRNA Refseq | NM_015239 |
Protein Refseq | NP_056054 |
MIM | 606830 |
UniProt ID | Q9UPW5 |
◆ Recombinant Proteins | ||
AGTPBP1-445H | Recombinant Human AGTPBP1 Protein, GST-tagged | +Inquiry |
AGTPBP1-1118H | Recombinant Human AGTPBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Agtpbp1-1562M | Recombinant Mouse Agtpbp1 Protein, Myc/DDK-tagged | +Inquiry |
AGTPBP1-2444H | Recombinant Human AGTPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGTPBP1-1429M | Recombinant Mouse AGTPBP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGTPBP1-38HCL | Recombinant Human AGTPBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTPBP1 Products
Required fields are marked with *
My Review for All AGTPBP1 Products
Required fields are marked with *
0
Inquiry Basket