Recombinant Human AGTR2 protein, GST-tagged
Cat.No. : | AGTR2-8654H |
Product Overview : | Recombinant Human AGTR2 protein(1-45 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-45 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD |
Gene Name | AGTR2 angiotensin II receptor, type 2 [ Homo sapiens ] |
Official Symbol | AGTR2 |
Synonyms | AGTR2; angiotensin II receptor, type 2; angiotensin receptor 2; type-2 angiotensin II receptor; AT2; MRX88; angiotensin II type-2 receptor; ATGR2; |
Gene ID | 186 |
mRNA Refseq | NM_000686 |
Protein Refseq | NP_000677 |
MIM | 300034 |
UniProt ID | P50052 |
◆ Recombinant Proteins | ||
RFL-21796MF | Recombinant Full Length Mouse Type-2 Angiotensin Ii Receptor(Agtr2) Protein, His-Tagged | +Inquiry |
RFL29720OF | Recombinant Full Length Sheep Type-2 Angiotensin Ii Receptor(Agtr2) Protein, His-Tagged | +Inquiry |
AGTR2-2130Z | Recombinant Zebrafish AGTR2 | +Inquiry |
AGTR2-8654H | Recombinant Human AGTR2 protein, GST-tagged | +Inquiry |
AGTR2-2445H | Recombinant Human AGTR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGTR2-8969HCL | Recombinant Human AGTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGTR2 Products
Required fields are marked with *
My Review for All AGTR2 Products
Required fields are marked with *
0
Inquiry Basket