Recombinant Human AHSA2 Protein, GST-tagged
| Cat.No. : | AHSA2-468H |
| Product Overview : | Human AHSA2 full-length ORF ( NP_689605.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | AHSA2 (Activator Of HSP90 ATPase Homolog 2) is a Protein Coding gene. GO annotations related to this gene include chaperone binding and ATPase activator activity. An important paralog of this gene is AHSA1. |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLTPLNG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AHSA2 AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) [ Homo sapiens ] |
| Official Symbol | AHSA2 |
| Synonyms | AHSA2; AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast); activator of 90 kDa heat shock protein ATPase homolog 2; DKFZp564C236; Hch1; FLJ34679; FLJ41715; |
| Gene ID | 130872 |
| mRNA Refseq | NM_152392 |
| Protein Refseq | NP_689605 |
| UniProt ID | Q719I0 |
| ◆ Recombinant Proteins | ||
| AHSA2-468H | Recombinant Human AHSA2 Protein, GST-tagged | +Inquiry |
| AHSA2-951HF | Recombinant Full Length Human AHSA2 Protein, GST-tagged | +Inquiry |
| AHSA2-5854H | Recombinant Human AHSA2 protein, His-tagged | +Inquiry |
| AHSA2-407M | Recombinant Mouse AHSA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AHSA2-9500H | Recombinant Human AHSA2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AHSA2-8960HCL | Recombinant Human AHSA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSA2 Products
Required fields are marked with *
My Review for All AHSA2 Products
Required fields are marked with *
