Recombinant Human AHSA2 Protein, GST-tagged

Cat.No. : AHSA2-468H
Product Overview : Human AHSA2 full-length ORF ( NP_689605.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AHSA2 (Activator Of HSP90 ATPase Homolog 2) is a Protein Coding gene. GO annotations related to this gene include chaperone binding and ATPase activator activity. An important paralog of this gene is AHSA1.
Molecular Mass : 42.1 kDa
AA Sequence : MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLTPLNG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AHSA2 AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) [ Homo sapiens ]
Official Symbol AHSA2
Synonyms AHSA2; AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast); activator of 90 kDa heat shock protein ATPase homolog 2; DKFZp564C236; Hch1; FLJ34679; FLJ41715;
Gene ID 130872
mRNA Refseq NM_152392
Protein Refseq NP_689605
UniProt ID Q719I0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHSA2 Products

Required fields are marked with *

My Review for All AHSA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon