Recombinant Human AIDA Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AIDA-841H |
| Product Overview : | AIDA MS Standard C13 and N15-labeled recombinant protein (NP_073742) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling. |
| Molecular Mass : | 35 kDa |
| AA Sequence : | MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | AIDA axin interactor, dorsalization associated [ Homo sapiens (human) ] |
| Official Symbol | AIDA |
| Synonyms | AIDA; axin interactor, dorsalization associated; C1orf80, chromosome 1 open reading frame 80; axin interactor, dorsalization-associated protein; axin interaction partner and dorsalization antagonist; FLJ12806; C1orf80; FLJ32421; RP11-378J18.7; |
| Gene ID | 64853 |
| mRNA Refseq | NM_022831 |
| Protein Refseq | NP_073742 |
| MIM | 612375 |
| UniProt ID | Q96BJ3 |
| ◆ Recombinant Proteins | ||
| AIDA-7533H | Recombinant Human AIDA, His-tagged | +Inquiry |
| AIDA-4857HF | Recombinant Full Length Human AIDA Protein, GST-tagged | +Inquiry |
| AIDA-410M | Recombinant Mouse AIDA Protein, His (Fc)-Avi-tagged | +Inquiry |
| AIDA-286C | Recombinant Cynomolgus AIDA Protein, His-tagged | +Inquiry |
| Aida-393M | Recombinant Mouse Aida Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIDA-8957HCL | Recombinant Human AIDA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIDA Products
Required fields are marked with *
My Review for All AIDA Products
Required fields are marked with *
