Recombinant Human AIF1 Protein, GST-tagged

Cat.No. : AIF1-472H
Product Overview : Human AIF1 full-length ORF ( AAH09474.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]
Molecular Mass : 41.91 kDa
AA Sequence : MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AIF1 allograft inflammatory factor 1 [ Homo sapiens ]
Official Symbol AIF1
Synonyms AIF1; allograft inflammatory factor 1; AIF 1; Em:AF129756.17; IBA1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; IRT 1; protein G1; ionized calcium-binding adapter molecule 1; allograft inflammatory factor-1 splice variant Hara-1; IRT1; AIF-1; IRT-1;
Gene ID 199
mRNA Refseq NM_001623
Protein Refseq NP_001614
MIM 601833
UniProt ID P55008

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIF1 Products

Required fields are marked with *

My Review for All AIF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon