Recombinant Human AIF1 Protein, GST-tagged
Cat.No. : | AIF1-472H |
Product Overview : | Human AIF1 full-length ORF ( AAH09474.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 41.91 kDa |
AA Sequence : | MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AIF1 allograft inflammatory factor 1 [ Homo sapiens ] |
Official Symbol | AIF1 |
Synonyms | AIF1; allograft inflammatory factor 1; AIF 1; Em:AF129756.17; IBA1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; IRT 1; protein G1; ionized calcium-binding adapter molecule 1; allograft inflammatory factor-1 splice variant Hara-1; IRT1; AIF-1; IRT-1; |
Gene ID | 199 |
mRNA Refseq | NM_001623 |
Protein Refseq | NP_001614 |
MIM | 601833 |
UniProt ID | P55008 |
◆ Recombinant Proteins | ||
AIF1-6900H | Recombinant Human Allograft Inflammatory Factor 1, His-tagged | +Inquiry |
AIF1-506P | Recombinant Pig AIF1 Protein, His/GST-tagged | +Inquiry |
AIF1-1449M | Recombinant Mouse AIF1 Protein | +Inquiry |
AIF1-100H | Recombinant Human AIF1, His-tagged | +Inquiry |
Aif1-558M | Recombinant Mouse Aif1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIF1 Products
Required fields are marked with *
My Review for All AIF1 Products
Required fields are marked with *