Recombinant Human AIFM1, His-tagged

Cat.No. : AIFM1-21H
Product Overview : Recombinant Human Apoptosis-Inducing Factor 1, Mitochondrial/AIFM1 is produced by our E. coli expression system. The target protein is expressed with sequence (Glu121-Asp613) of Human AIFM1 fused with a 6His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 121-613 a.a.
Description : Apoptosis-Inducing Factor 1, Mitochondrial (AIFM1) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. During apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces parthanatos i.e., caspase-independent fragmentation of chromosomal DNA. AIFM1 interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. It binds to DNA in a sequence-independent manner and plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : MGSSHHHHHHSSGLVPRGSHMEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSE DPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLT GKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLE KISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRRE GVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVN AELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPD VGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAP VQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name AIFM1 apoptosis-inducing factor, mitochondrion-associated, 1 [ Homo sapiens ]
Official Symbol AIFM1
Synonyms AIFM1; apoptosis-inducing factor, mitochondrion-associated, 1; PDCD8, programmed cell death 8 (apoptosis inducing factor); apoptosis-inducing factor 1, mitochondrial; AIF; striatal apoptosis-inducing factor; programmed cell death 8 (apoptosis-inducing factor); PDCD8; COXPD6; MGC111425;
Gene ID 9131
mRNA Refseq NM_001130846
Protein Refseq NP_001124318
MIM 300169
UniProt ID O95831
Chromosome Location Xq26.1
Pathway Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Apoptosis Modulation by HSP70, organism-specific biosystem; Ceramide signaling pathway, organism-specific biosystem;
Function DNA binding; electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIFM1 Products

Required fields are marked with *

My Review for All AIFM1 Products

Required fields are marked with *

0
cart-icon