Recombinant Human AIFM1, His-tagged
Cat.No. : | AIFM1-21H |
Product Overview : | Recombinant Human Apoptosis-Inducing Factor 1, Mitochondrial/AIFM1 is produced by our E. coli expression system. The target protein is expressed with sequence (Glu121-Asp613) of Human AIFM1 fused with a 6His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 121-613 a.a. |
Description : | Apoptosis-Inducing Factor 1, Mitochondrial (AIFM1) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. During apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces parthanatos i.e., caspase-independent fragmentation of chromosomal DNA. AIFM1 interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. It binds to DNA in a sequence-independent manner and plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSE DPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLT GKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLE KISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRRE GVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVN AELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPD VGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAP VQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | AIFM1 apoptosis-inducing factor, mitochondrion-associated, 1 [ Homo sapiens ] |
Official Symbol | AIFM1 |
Synonyms | AIFM1; apoptosis-inducing factor, mitochondrion-associated, 1; PDCD8, programmed cell death 8 (apoptosis inducing factor); apoptosis-inducing factor 1, mitochondrial; AIF; striatal apoptosis-inducing factor; programmed cell death 8 (apoptosis-inducing factor); PDCD8; COXPD6; MGC111425; |
Gene ID | 9131 |
mRNA Refseq | NM_001130846 |
Protein Refseq | NP_001124318 |
MIM | 300169 |
UniProt ID | O95831 |
Chromosome Location | Xq26.1 |
Pathway | Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Apoptosis Modulation by HSP70, organism-specific biosystem; Ceramide signaling pathway, organism-specific biosystem; |
Function | DNA binding; electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity; protein binding; |
◆ Recombinant Proteins | ||
Aifm1-104R | Recombinant Rat Aifm1 Protein, His-tagged | +Inquiry |
AIFM1-107R | Recombinant Rhesus Macaque AIFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIFM1-576R | Recombinant Rat AIFM1 Protein | +Inquiry |
AIFM1-5102H | Recombinant Human AIFM1, His-tagged | +Inquiry |
AIFM1-473H | Recombinant Human AIFM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM1-8954HCL | Recombinant Human AIFM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIFM1 Products
Required fields are marked with *
My Review for All AIFM1 Products
Required fields are marked with *
0
Inquiry Basket