Recombinant Human AK3L1 Protein, GST-tagged
Cat.No. : | AK4-488H |
Product Overview : | Human AK3L1 full-length ORF ( AAH16180, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.27 kDa |
AA Sequence : | MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AK4 adenylate kinase 4 [ Homo sapiens (human) ] |
Official Symbol | AK4 |
Synonyms | AK4; adenylate kinase 4; AK3; AK 4; AK3L1; AK3L2; adenylate kinase 4, mitochondrial; ATP-AMP transphosphorylase; GTP:AMP phosphotransferase AK4, mitochondrial; adenylate kinase 3-like 1; adenylate kinase isoenzyme 4, mitochondrial; mitochondrial adenylate kinase-3; nucleoside-triphosphate-adenylate kinase; EC 2.7.4.10; EC 2.7.4.6 |
Gene ID | 205 |
mRNA Refseq | NM_001005353 |
Protein Refseq | NP_001005353 |
MIM | 103030 |
UniProt ID | P27144 |
◆ Recombinant Proteins | ||
AK4-463H | Recombinant Human AK4, Gly & Pro tagged | +Inquiry |
AK4-965HF | Recombinant Full Length Human AK4 Protein, GST-tagged | +Inquiry |
AK4-27152TH | Recombinant Human AK4, His-tagged | +Inquiry |
Ak4-563M | Recombinant Mouse Ak4 Protein, MYC/DDK-tagged | +Inquiry |
AK4-2606H | Recombinant Human AK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK4-001HCL | Recombinant Human AK4 cell lysate | +Inquiry |
AK4-8945HCL | Recombinant Human AK3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK4 Products
Required fields are marked with *
My Review for All AK4 Products
Required fields are marked with *