Recombinant Human AK4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AK4-2606H
Product Overview : AK3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001005353) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.
Molecular Mass : 25.3 kDa
AA Sequence : MASKLLRAVILGPPGSGKGTVSQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AK4 adenylate kinase 4 [ Homo sapiens (human) ]
Official Symbol AK4
Synonyms AK4; adenylate kinase 4; adenylate kinase 3, adenylate kinase 3 like 1, AK3, AK3L1; adenylate kinase isoenzyme 4, mitochondrial; adenylate kinase 3-like 1; ATP-AMP transphosphorylase; GTP:AMP phosphotransferase; mitochondrial adenylate kinase-3; nucleoside-triphosphate-adenylate kinase; AK3; AK3L1; AK3L2; MGC166959;
Gene ID 205
mRNA Refseq NM_001005353
Protein Refseq NP_001005353
MIM 103030
UniProt ID P27144

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AK4 Products

Required fields are marked with *

My Review for All AK4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon