Recombinant Human AK4, His-tagged
Cat.No. : | AK4-26525TH |
Product Overview : | Recombinant full length Human AK3L1 (amino acids 1-223) with an N terminal His tag; 243 amino acids with tag, Predicted MWt 27.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 223 amino acids |
Description : | This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. |
Conjugation : | HIS |
Molecular Weight : | 27.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY |
Sequence Similarities : | Belongs to the adenylate kinase family. |
Gene Name | AK4 adenylate kinase 4 [ Homo sapiens ] |
Official Symbol | AK4 |
Synonyms | AK4; adenylate kinase 4; adenylate kinase 3 , adenylate kinase 3 like 1 , AK3, AK3L1; adenylate kinase isoenzyme 4, mitochondrial; |
Gene ID | 205 |
mRNA Refseq | NM_001005353 |
Protein Refseq | NP_001005353 |
MIM | 103030 |
Uniprot ID | P27144 |
Chromosome Location | 1p31.3 |
Pathway | Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
Function | ATP binding; GTP binding; adenylate kinase activity; nucleotide binding; transferase activity; |
◆ Recombinant Proteins | ||
AK4-3973H | Recombinant Human AK4 protein(Ala2-Tyr223), His&GST-tagged | +Inquiry |
AK4-241R | Recombinant Rat AK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK4-463H | Recombinant Human AK4, Gly & Pro tagged | +Inquiry |
AK4-965HF | Recombinant Full Length Human AK4 Protein, GST-tagged | +Inquiry |
AK4-488H | Recombinant Human AK3L1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK4-8945HCL | Recombinant Human AK3L1 293 Cell Lysate | +Inquiry |
AK4-001HCL | Recombinant Human AK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK4 Products
Required fields are marked with *
My Review for All AK4 Products
Required fields are marked with *