Recombinant Human AKAP11 Protein, GST-tagged

Cat.No. : AKAP11-397H
Product Overview : Human AKAP11 partial ORF ( NP_057332, 1801 a.a. - 1901 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed at high levels throughout spermatogenesis and in mature sperm. It binds the RI and RII subunits of PKA in testis. It may serve a function in cell cycle control of both somatic cells and germ cells in addition to its putative role in spermatogenesis and sperm function. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.85 kDa
AA Sequence : EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKAP11 A-kinase anchoring protein 11 [ Homo sapiens (human) ]
Official Symbol AKAP11
Synonyms AKAP11; A-kinase anchoring protein 11; PRKA11; AKAP-11; AKAP220; PPP1R44; A-kinase anchor protein 11; A kinase (PRKA) anchor protein 11; A-kinase anchor protein 220 kDa; A-kinase anchoring protein, 220kDa; a kinase anchor protein 220 kDa; protein kinase A anchoring protein 11; protein phosphatase 1, regulatory subunit 44
Gene ID 11215
mRNA Refseq NM_016248
Protein Refseq NP_057332
MIM 604696
UniProt ID Q9UKA4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP11 Products

Required fields are marked with *

My Review for All AKAP11 Products

Required fields are marked with *

0
cart-icon
0
compare icon