Recombinant Human AKAP5, His-tagged

• Cat.No.: AKAP5-23H
• Product Overview: Recombinant Human A-Kinase Anchor Protein 5/AKAP5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln427) of Human AKAP5 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-427 a.a.
• Description: A-Kinase Anchor Protein 5 (AKAP5) is a member of the AKAP family. AKAP5 contains one AKAP domain and is predominantly expressed in the cerebral cortex. AKAP5 may anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. AKAP5 association with to the β-2-adrenergic receptor (β2-AR) not only regulates β2-AR signaling pathway, but also the activation by PKA by switching off the β2-AR signaling cascade.
• AA Sequence: METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQE AGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCI KFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVC ESNVSNSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQP VLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEE KSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYET LLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: AKAP5 A kinase (PRKA) anchor protein 5 [ Homo sapiens ]
• Official Symbol: AKAP5
• Synonyms: AKAP5; A kinase (PRKA) anchor protein 5; A-kinase anchor protein 5; AKAP75; AKAP79; AKAP-5; AKAP 79; A-kinase anchor protein 79 kDa; A-kinase anchor protein, 79kDa; A-kinase anchoring protein 75/79; cAMP-dependent protein kinase regulatory subunit II high affinity binding protein; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein; H21
• Gene ID: 9495
• mRNA Refseq: NM_004857
• Protein Refseq: NP_004848
• MIM: 604688
• UniProt ID: P24588
• Chromosome Location: 14q21-q24
• Pathway: Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; Glutamate Binding, Activation of AMPA Receptors and Synaptic Plasticity, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter Receptor Binding And Downstream Transmission In ThePostsynaptic Cell, organism-specific biosystem
• Function: adenylate cyclase binding; calmodulin binding; protein binding; protein kinase A binding