Recombinant Human AKAP7 Protein, GST-tagged
Cat.No. : | AKAP7-402H |
Product Overview : | Human AKAP7 full-length ORF ( AAH16927, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011] |
Molecular Mass : | 34.65 kDa |
AA Sequence : | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ] |
Official Symbol | AKAP7 |
Synonyms | AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; AKAP 18; PRKA7 isoform gamma; AKAP-7 isoform gamma; PRKA7 isoforms alpha/beta; A-kinase anchor protein 9 kDa; A-kinase anchor protein 18 kDa; AKAP-7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms alpha and beta; |
Gene ID | 9465 |
mRNA Refseq | NM_004842 |
Protein Refseq | NP_004833 |
MIM | 604693 |
UniProt ID | O43687 |
◆ Recombinant Proteins | ||
Akap7-3031M | Recombinant Mouse Akap7, GST-tagged | +Inquiry |
AKAP7-101H | Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
AKAP7-26524TH | Recombinant Human AKAP7 | +Inquiry |
AKAP7-593R | Recombinant Rat AKAP7 Protein | +Inquiry |
AKAP7-9524H | Recombinant Human AKAP7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP7-8938HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
AKAP7-8937HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP7 Products
Required fields are marked with *
My Review for All AKAP7 Products
Required fields are marked with *