Recombinant Human AKAP7 protein, GST-tagged
| Cat.No. : | AKAP7-9524H |
| Product Overview : | Recombinant Human AKAP7 protein(1-81 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | August 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HIV1 |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-81 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
| Gene Name | AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ] |
| Official Symbol | AKAP7 |
| Synonyms | AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; AKAP 18; PRKA7 isoform gamma; AKAP-7 isoform gamma; PRKA7 isoforms alpha/beta; A-kinase anchor protein 9 kDa; A-kinase anchor protein 18 kDa; AKAP-7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms alpha and beta; |
| Gene ID | 9465 |
| mRNA Refseq | NM_004842 |
| Protein Refseq | NP_004833 |
| MIM | 604693 |
| UniProt ID | O43687 |
| ◆ Recombinant Proteins | ||
| AKAP7-1068H | Recombinant Human AKAP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AKAP7-101H | Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AKAP7-402H | Recombinant Human AKAP7 Protein, GST-tagged | +Inquiry |
| Akap7-3031M | Recombinant Mouse Akap7, GST-tagged | +Inquiry |
| AKAP7-2395H | Recombinant Human A-kinase (PRKA) Anchor Protein 7, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKAP7-8938HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
| AKAP7-8937HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP7 Products
Required fields are marked with *
My Review for All AKAP7 Products
Required fields are marked with *
