Recombinant Human AKAP7 protein, His-tagged
Cat.No. : | AKAP7-9025H |
Product Overview : | Recombinant Human AKAP7 protein(1-81 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-81 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
Gene Name | AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ] |
Official Symbol | AKAP7 |
Synonyms | AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; AKAP 18; PRKA7 isoform gamma; AKAP-7 isoform gamma; PRKA7 isoforms alpha/beta; A-kinase anchor protein 9 kDa; A-kinase anchor protein 18 kDa; AKAP-7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms alpha and beta; |
Gene ID | 9465 |
mRNA Refseq | NM_004842 |
Protein Refseq | NP_004833 |
MIM | 604693 |
UniProt ID | O43687 |
◆ Recombinant Proteins | ||
AKAP7-2395H | Recombinant Human A-kinase (PRKA) Anchor Protein 7, His-tagged | +Inquiry |
AKAP7-593R | Recombinant Rat AKAP7 Protein | +Inquiry |
AKAP7-101H | Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
AKAP7-1351HF | Recombinant Full Length Human AKAP7 Protein, GST-tagged | +Inquiry |
AKAP7-402H | Recombinant Human AKAP7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP7-8937HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
AKAP7-8938HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP7 Products
Required fields are marked with *
My Review for All AKAP7 Products
Required fields are marked with *
0
Inquiry Basket