Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : AKAP7-101H
Product Overview : AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Mass : 8.8 kDa
AA Sequence : MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AKAP7 A-kinase anchoring protein 7 [ Homo sapiens (human) ]
Official Symbol AKAP7
Synonyms AKAP7; A-kinase anchoring protein 7; AKAP15; AKAP18; A-kinase anchoring protein 7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 18 kDa; A-kinase anchor protein 9 kDa; AKAP 18
Gene ID 9465
mRNA Refseq NM_004842
Protein Refseq NP_004833
MIM 604693
UniProt ID O43687

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP7 Products

Required fields are marked with *

My Review for All AKAP7 Products

Required fields are marked with *

0
cart-icon
0
compare icon