Recombinant Human AKR1B1 protein, GST-tagged
Cat.No. : | AKR1B1-1219H |
Product Overview : | Recombinant Human AKR1B1 protein(1-316 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-316 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF |
Gene Name | AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase) [ Homo sapiens ] |
Official Symbol | AKR1B1 |
Synonyms | AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804; |
Gene ID | 231 |
mRNA Refseq | NM_001628 |
Protein Refseq | NP_001619 |
MIM | 103880 |
UniProt ID | P15121 |
◆ Recombinant Proteins | ||
ABRA-227M | Recombinant Mouse ABRA Protein, His (Fc)-Avi-tagged | +Inquiry |
ABRA-2621H | Recombinant Human ABRA protein, His-tagged | +Inquiry |
ABRA-1149M | Recombinant Mouse ABRA Protein | +Inquiry |
ABRA-428R | Recombinant Rat ABRA Protein | +Inquiry |
ABRA-117H | Recombinant Human ABRA Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABRA-9121HCL | Recombinant Human ABRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABRA Products
Required fields are marked with *
My Review for All ABRA Products
Required fields are marked with *