Recombinant Human AKR1C8P Protein, GST-tagged
| Cat.No. : | AKR1C8P-415H |
| Product Overview : | Human AKR1CL1 full-length ORF ( NP_001007537.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | AKR1C8P (Aldo-Keto Reductase Family 1 Member C8, Pseudogene) is a Pseudogene. GO annotations related to this gene include oxidoreductase activity. |
| Molecular Mass : | 41 kDa |
| AA Sequence : | MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AKR1C8P aldo-keto reductase family 1 member C8, pseudogene [ Homo sapiens (human) ] |
| Official Symbol | AKR1C8P |
| Synonyms | AKR1C8P; aldo-keto reductase family 1 member C8, pseudogene; AKR1CL1; Aldo-Keto Reductase Family 1 Member C8, Pseudogene; Aldo-Keto Reductase Family 1, Member C-Like 1; Aldo-Keto Reductase Family 1 Member C-Like Protein 1; Protein RAKc; EC 1.1.1.- |
| Gene ID | 340811 |
| ◆ Recombinant Proteins | ||
| AKR1C8P-415H | Recombinant Human AKR1C8P Protein, GST-tagged | +Inquiry |
| AKR1C8P-1370HF | Recombinant Full Length Human AKR1C8P Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C8P Products
Required fields are marked with *
My Review for All AKR1C8P Products
Required fields are marked with *



