Recombinant Human AKR1C8P Protein, GST-tagged

• Cat.No.: AKR1C8P-415H
• Product Overview: Human AKR1CL1 full-length ORF ( NP_001007537.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AKR1C8P (Aldo-Keto Reductase Family 1 Member C8, Pseudogene) is a Pseudogene. GO annotations related to this gene include oxidoreductase activity.
• Molecular Mass: 41 kDa
• AA Sequence: MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKR1C8P aldo-keto reductase family 1 member C8, pseudogene [ Homo sapiens (human) ]
• Official Symbol: AKR1C8P
• Synonyms: AKR1C8P; aldo-keto reductase family 1 member C8, pseudogene; AKR1CL1; Aldo-Keto Reductase Family 1 Member C8, Pseudogene; Aldo-Keto Reductase Family 1, Member C-Like 1; Aldo-Keto Reductase Family 1 Member C-Like Protein 1; Protein RAKc; EC 1.1.1.-
• Gene ID: 340811