Recombinant Human AKR1E2 Protein, GST-tagged

Cat.No. : AKR1E2-416H
Product Overview : Human AKR1CL2 full-length ORF ( AAH02862, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the aldo-keto reductase superfamily. Members in this family are characterized by their structure (evolutionarily highly conserved TIM barrel) and function (NAD(P)H-dependent oxido-reduction of carbonyl groups). Transcripts of this gene have been reported in specimens of human testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Molecular Mass : 59.51 kDa
AA Sequence : MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKR1E2 aldo-keto reductase family 1, member E2 [ Homo sapiens ]
Official Symbol AKR1E2
Synonyms AKR1E2; aldo-keto reductase family 1, member E2; AKR1CL2, AKRDC1, aldo keto reductase family 1, member C like 2; 1,5-anhydro-D-fructose reductase; MGC10612; hTSP; AF reductase; testis-specific protein; aldo-keto reductase loopADR; aldo-keto reductase related protein; aldo-keto reductase family 1, member C-like 2; aldo-keto reductase family 1 member C-like protein 2; AKRDC1; AKR1CL2; LoopADR;
Gene ID 83592
mRNA Refseq NM_001040177
Protein Refseq NP_001035267
MIM 617451
UniProt ID Q96JD6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKR1E2 Products

Required fields are marked with *

My Review for All AKR1E2 Products

Required fields are marked with *

0
cart-icon
0
compare icon