Recombinant Human AKR1E2 Protein, GST-tagged

• Cat.No.: AKR1E2-416H
• Product Overview: Human AKR1CL2 full-length ORF ( AAH02862, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the aldo-keto reductase superfamily. Members in this family are characterized by their structure (evolutionarily highly conserved TIM barrel) and function (NAD(P)H-dependent oxido-reduction of carbonyl groups). Transcripts of this gene have been reported in specimens of human testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Molecular Mass: 59.51 kDa
• AA Sequence: MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKR1E2 aldo-keto reductase family 1, member E2 [ Homo sapiens ]
• Official Symbol: AKR1E2
• Synonyms: AKR1E2; aldo-keto reductase family 1, member E2; AKR1CL2, AKRDC1, aldo keto reductase family 1, member C like 2; 1,5-anhydro-D-fructose reductase; MGC10612; hTSP; AF reductase; testis-specific protein; aldo-keto reductase loopADR; aldo-keto reductase related protein; aldo-keto reductase family 1, member C-like 2; aldo-keto reductase family 1 member C-like protein 2; AKRDC1; AKR1CL2; LoopADR
• Gene ID: 83592
• mRNA Refseq: NM_001040177
• Protein Refseq: NP_001035267
• MIM: 617451
• UniProt ID: Q96JD6