Recombinant Human AKR7A2 protein, His-tagged
| Cat.No. : | AKR7A2-3703H |
| Product Overview : | Recombinant Human AKR7A2 protein(60-359 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 02, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 60-359 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AKR7A2 aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) [ Homo sapiens ] |
| Official Symbol | AKR7A2 |
| Synonyms | AKR7A2; aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase); aflatoxin B1 aldehyde reductase member 2; AFAR; AFB1-AR 1; SSA reductase; aldoketoreductase 7; AFB1 aldehyde reductase 1; succinic semialdehyde reductase; aflatoxin beta1 aldehyde reductase; AKR7; AFAR1; AFB1-AR1; |
| Gene ID | 8574 |
| mRNA Refseq | NM_003689 |
| Protein Refseq | NP_003680 |
| MIM | 603418 |
| UniProt ID | O43488 |
| ◆ Recombinant Proteins | ||
| AKR7A2-123R | Recombinant Rhesus Macaque AKR7A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AKR7A2-1934H | Recombinant Human AKR7A2, His-tagged | +Inquiry |
| AKR7A2-603R | Recombinant Rat AKR7A2 Protein | +Inquiry |
| AKR7A2-1377HF | Recombinant Full Length Human AKR7A2 Protein, GST-tagged | +Inquiry |
| AKR7A2-3703H | Recombinant Human AKR7A2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKR7A2-52HCL | Recombinant Human AKR7A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR7A2 Products
Required fields are marked with *
My Review for All AKR7A2 Products
Required fields are marked with *
