Recombinant Human AKR7A3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AKR7A3-2420H
Product Overview : AKR7A3 MS Standard C13 and N15-labeled recombinant protein (NP_036199) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.
Molecular Mass : 37.2 kDa
AA Sequence : MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFMELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIAPVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AKR7A3 aldo-keto reductase family 7 member A3 [ Homo sapiens (human) ]
Official Symbol AKR7A3
Synonyms AKR7A3; aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase); aflatoxin B1 aldehyde reductase member 3; AFB1-AR 2; AFB1 aldehyde reductase 2; aflatoxin B1 aldehyde reductase 2; AFAR2;
Gene ID 22977
mRNA Refseq NM_012067
Protein Refseq NP_036199
MIM 608477
UniProt ID O95154

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKR7A3 Products

Required fields are marked with *

My Review for All AKR7A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon