Recombinant Human AKR7A3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AKR7A3-2420H |
Product Overview : | AKR7A3 MS Standard C13 and N15-labeled recombinant protein (NP_036199) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFMELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIAPVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AKR7A3 aldo-keto reductase family 7 member A3 [ Homo sapiens (human) ] |
Official Symbol | AKR7A3 |
Synonyms | AKR7A3; aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase); aflatoxin B1 aldehyde reductase member 3; AFB1-AR 2; AFB1 aldehyde reductase 2; aflatoxin B1 aldehyde reductase 2; AFAR2; |
Gene ID | 22977 |
mRNA Refseq | NM_012067 |
Protein Refseq | NP_036199 |
MIM | 608477 |
UniProt ID | O95154 |
◆ Recombinant Proteins | ||
AKR7A3-9538H | Recombinant Human AKR7A3 protein, GST-tagged | +Inquiry |
AKR7A3-604R | Recombinant Rat AKR7A3 Protein | +Inquiry |
Akr7a3-3236R | Recombinant Rat Akr7a3, His-tagged | +Inquiry |
AKR7A3-260R | Recombinant Rat AKR7A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR7A3-513Z | Recombinant Zebrafish AKR7A3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR7A3-53HCL | Recombinant Human AKR7A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR7A3 Products
Required fields are marked with *
My Review for All AKR7A3 Products
Required fields are marked with *
0
Inquiry Basket