Recombinant Human ALDH1B1 protein, His-GST&V5-Myc-tagged
Cat.No. : | ALDH1B1-553H |
Product Overview : | Recombinant Human ALDH1B1 protein(P30837)(167-264aa), fused with N-terminal His and GST tag and C-terminal V5 and Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc&V5 |
Protein Length : | 167-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSY |
Gene Name | ALDH1B1 aldehyde dehydrogenase 1 family, member B1 [ Homo sapiens ] |
Official Symbol | ALDH1B1 |
Synonyms | ALDH1B1; aldehyde dehydrogenase 1 family, member B1; ALDH5; aldehyde dehydrogenase X, mitochondrial; ALDHX; ALDH class 2; aldehyde dehydrogenase 5; acetaldehyde dehydrogenase 5; MGC2230; |
Gene ID | 219 |
mRNA Refseq | NM_000692 |
Protein Refseq | NP_000683 |
MIM | 100670 |
UniProt ID | P30837 |
◆ Recombinant Proteins | ||
ALDH1B1-490H | Recombinant Human Aldehyde Dehydrogenase 1 Family, Member B1, GST-tagged | +Inquiry |
ALDH1B1-0562H | Recombinant Human ALDH1B1 Protein (Arg18-Ser517), N-His-tagged | +Inquiry |
ALDH1B1-488H | Recombinant Human Aldehyde Dehydrogenase 1 Family, Member B1, GST-tagged | +Inquiry |
ALDH1B1-1040HFL | Recombinant Full Length Human ALDH1B1 Protein, C-Flag-tagged | +Inquiry |
ALDH1B1-312H | Recombinant Human ALDH1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1B1-16HCL | Recombinant Human ALDH1B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH1B1 Products
Required fields are marked with *
My Review for All ALDH1B1 Products
Required fields are marked with *