Recombinant Human ALDOA
Cat.No. : | ALDOA-26497TH |
Product Overview : | Recombinant full length Human Aldolase expressed in Saccharomyces cerevisiae; 364 amino acids, MWt 39.4 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGE HTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMV TPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLS GGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASA LKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY |
Full Length : | Full L. |
Gene Name | ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ] |
Official Symbol | ALDOA |
Synonyms | ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A; |
Gene ID | 226 |
mRNA Refseq | NM_000034 |
Protein Refseq | NP_000025 |
MIM | 103850 |
Uniprot ID | P04075 |
Chromosome Location | 16p11.2 |
Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; |
Function | actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding; |
◆ Recombinant Proteins | ||
ALDOA-0643H | Recombinant Human ALDOA Protein (Asp18-Gly273), N-His-tagged | +Inquiry |
ALDOA-2632H | Recombinant Human ALDOA protein, His-tagged | +Inquiry |
ALDOA-2509H | Recombinant Human ALDOA protein, GST-tagged | +Inquiry |
ALDOA-0644H | Recombinant Human ALDOA Protein (Pro2-Tyr364), C-His-tagged | +Inquiry |
ALDOA-651H | Recombinant Human ALDOA protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDOA-8912HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
ALDOA-8913HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDOA Products
Required fields are marked with *
My Review for All ALDOA Products
Required fields are marked with *