Recombinant Human ALDOA, His-tagged
Cat.No. : | ALDOA-26500TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-364 of Human Aldolase with an N-terminal His tag; Predicted MWt 40kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 71 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPL AGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI GEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPN MVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITF LSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQA SALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPS GQAGAAASESLFVSNHAY |
Gene Name : | ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ] |
Official Symbol : | ALDOA |
Synonyms : | ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A; |
Gene ID : | 226 |
mRNA Refseq : | NM_000034 |
Protein Refseq : | NP_000025 |
MIM : | 103850 |
Uniprot ID : | P04075 |
Chromosome Location : | 16p11.2 |
Pathway : | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; |
Function : | actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding; |
Products Types
◆ Recombinant Protein | ||
ALDOA-316H | Recombinant Human ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
Aldoa-573M | Recombinant Mouse Aldoa Protein, MYC/DDK-tagged | +Inquiry |
ALDOA-281R | Recombinant Rat ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDOA-455H | Recombinant Human ALDOA Protein, GST-tagged | +Inquiry |
Aldoa-1520M | Recombinant Mouse Aldoa protein, His-tagged | +Inquiry |
◆ Lysates | ||
ALDOA-8912HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
ALDOA-8913HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket