Recombinant Human ALDOA, His-tagged
| Cat.No. : | ALDOA-26500TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-364 of Human Aldolase with an N-terminal His tag; Predicted MWt 40kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-364 a.a. |
| Description : | The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 71 μl aqua dest |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPL AGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKI GEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPN MVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITF LSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQA SALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPS GQAGAAASESLFVSNHAY |
| Full Length : | Full L. |
| Gene Name | ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ] |
| Official Symbol | ALDOA |
| Synonyms | ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A; |
| Gene ID | 226 |
| mRNA Refseq | NM_000034 |
| Protein Refseq | NP_000025 |
| MIM | 103850 |
| Uniprot ID | P04075 |
| Chromosome Location | 16p11.2 |
| Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; |
| Function | actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding; |
| ◆ Recombinant Proteins | ||
| ALDOA-5775H | Recombinant Human ALDOA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ALDOA-281R | Recombinant Rat ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALDOA-4521H | Recombinant Human ALDOA protein, His-tagged | +Inquiry |
| ALDOA-1421HF | Recombinant Full Length Human ALDOA Protein, GST-tagged | +Inquiry |
| ALDOA-924H | Recombinant Human ALDOA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALDOA-8913HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
| ALDOA-8912HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDOA Products
Required fields are marked with *
My Review for All ALDOA Products
Required fields are marked with *



