Recombinant Human ALKBH1 protein, His-tagged
| Cat.No. : | ALKBH1-2882H |
| Product Overview : | Recombinant Human ALKBH1 protein(15 - 169 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 15 - 169 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ALKBH1 alkB, alkylation repair homolog 1 (E. coli) [ Homo sapiens ] |
| Official Symbol | ALKBH1 |
| Synonyms | ALKBH1; alkB, alkylation repair homolog 1 (E. coli); alkB, alkylation repair homolog (E. coli) , ALKBH; alkylated DNA repair protein alkB homolog 1; ABH; alkB; hABH; DNA lyase ABH1; alkylation repair, alkB homolog; alpha-ketoglutarate-dependent dioxygenase ABH1; ABH1; ALKBH; |
| Gene ID | 8846 |
| mRNA Refseq | NM_006020 |
| Protein Refseq | NP_006011 |
| MIM | 605345 |
| UniProt ID | Q13686 |
| ◆ Recombinant Proteins | ||
| Alkbh1-3273M | Recombinant Mouse Alkbh1, His-tagged | +Inquiry |
| ALKBH1-2853Z | Recombinant Zebrafish ALKBH1 | +Inquiry |
| ALKBH1-473M | Recombinant Mouse ALKBH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALKBH1-474H | Recombinant Human ALKBH1 Protein, GST-tagged | +Inquiry |
| ALKBH1-223HFL | Recombinant Full Length Human ALKBH1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALKBH1-8903HCL | Recombinant Human ALKBH1 293 Cell Lysate | +Inquiry |
| ALKBH1-325HKCL | Human ALKBH1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALKBH1 Products
Required fields are marked with *
My Review for All ALKBH1 Products
Required fields are marked with *
