Recombinant Human ALOX12P2 Protein, GST-tagged
| Cat.No. : | ALOX12P2-484H |
| Product Overview : | Human ALOX12P2 full-length ORF ( AAH41851.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ALOX12P2 (Arachidonate 12-Lipoxygenase Pseudogene 2) is a Pseudogene. |
| Molecular Mass : | 55.5 kDa |
| AA Sequence : | MVKLRKHNVLLSLDWFCKWISVQGPGTQGAAFFPCYRWVQGHGIICLPEGTARTVSDDPQNLFKKYREQELEERRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFNVSLAKGLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPMLLRCTSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQCVAAPLVMLKLQPDGGLLPMVIQLQPP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALOX12P2 arachidonate 12-lipoxygenase pseudogene 2 [ Homo sapiens (human) ] |
| Official Symbol | ALOX12P2 |
| Synonyms | ALOX12P2; arachidonate 12-lipoxygenase pseudogene; ALOX12E; 12-lipoxygenase-related protein; hair and skin epidermal-type 12-lipoxygenase-related pseudogene |
| Gene ID | 245 |
| ◆ Recombinant Proteins | ||
| ALOX12P2-484H | Recombinant Human ALOX12P2 Protein, GST-tagged | +Inquiry |
| ALOX12P2-1478HF | Recombinant Full Length Human ALOX12P2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALOX12P2 Products
Required fields are marked with *
My Review for All ALOX12P2 Products
Required fields are marked with *



