Recombinant Human ALOX12P2 Protein, GST-tagged

• Cat.No.: ALOX12P2-484H
• Product Overview: Human ALOX12P2 full-length ORF ( AAH41851.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ALOX12P2 (Arachidonate 12-Lipoxygenase Pseudogene 2) is a Pseudogene.
• Molecular Mass: 55.5 kDa
• AA Sequence: MVKLRKHNVLLSLDWFCKWISVQGPGTQGAAFFPCYRWVQGHGIICLPEGTARTVSDDPQNLFKKYREQELEERRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFNVSLAKGLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPMLLRCTSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQCVAAPLVMLKLQPDGGLLPMVIQLQPP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALOX12P2 arachidonate 12-lipoxygenase pseudogene 2 [ Homo sapiens (human) ]
• Official Symbol: ALOX12P2
• Synonyms: ALOX12P2; arachidonate 12-lipoxygenase pseudogene; ALOX12E; 12-lipoxygenase-related protein; hair and skin epidermal-type 12-lipoxygenase-related pseudogene
• Gene ID: 245