Recombinant Human ALOX5AP

Cat.No. : ALOX5AP-27299TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-161 of Human FLAP, with an N-terminal proprietary tag, Predicted MWt 43.45 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 161 amino acids
Description : This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Molecular Weight : 43.450kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGR SFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLI P
Sequence Similarities : Belongs to the MAPEG family.
Gene Name ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ]
Official Symbol ALOX5AP
Synonyms ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein;
Gene ID 241
mRNA Refseq NM_001204406
Protein Refseq NP_001191335
MIM 603700
Uniprot ID P20292
Chromosome Location 13q12
Pathway Eicosanoid Synthesis, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; Selenium Pathway, organism-specific biosystem;
Function arachidonate 5-lipoxygenase activity; arachidonic acid binding; enzyme activator activity; enzyme binding; NOT glutathione peroxidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALOX5AP Products

Required fields are marked with *

My Review for All ALOX5AP Products

Required fields are marked with *

0
cart-icon
0
compare icon