Recombinant Human ALOX5AP Protein, GST-tagged
Cat.No. : | ALOX5AP-488H |
Product Overview : | Human ALOX5AP full-length ORF ( AAH18538, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011] |
Molecular Mass : | 43.45 kDa |
AA Sequence : | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ] |
Official Symbol | ALOX5AP |
Synonyms | ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein; MK-886-binding protein; |
Gene ID | 241 |
mRNA Refseq | NM_001204406 |
Protein Refseq | NP_001191335 |
MIM | 603700 |
UniProt ID | P20292 |
◆ Recombinant Proteins | ||
ALOX5AP-137R | Recombinant Rhesus Macaque ALOX5AP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-31256HF | Recombinant Full Length Human Arachidonate 5-Lipoxygenase-Activating Protein(Alox5Ap) Protein, His-Tagged | +Inquiry |
ALOX5AP-1482HF | Recombinant Full Length Human ALOX5AP Protein, GST-tagged | +Inquiry |
ALOX5AP-22HF | Recombinant Full Length Human ALOX5AP Protein | +Inquiry |
Alox5ap-585M | Recombinant Mouse Alox5ap Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX5AP-667HCL | Recombinant Human ALOX5AP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX5AP Products
Required fields are marked with *
My Review for All ALOX5AP Products
Required fields are marked with *
0
Inquiry Basket