Recombinant Human ALPK1 Protein, GST-tagged
| Cat.No. : | ALPK1-491H |
| Product Overview : | Human ALPK1 partial ORF ( NP_079420.2, 1147 a.a. - 1242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an alpha kinase. Mice which were homozygous for disrupted copies of this gene exhibited coordination defects (PMID: 21208416). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | VVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALPK1 alpha-kinase 1 [ Homo sapiens ] |
| Official Symbol | ALPK1 |
| Synonyms | ALPK1; alpha-kinase 1; alpha-protein kinase 1; FLJ22670; KIAA1527; Lak; lymphocyte alpha kinase; chromosome 4 kinase; lymphocyte alpha-kinase; lymphocyte alpha-protein kinase; LAK; 8430410J10Rik; |
| Gene ID | 80216 |
| mRNA Refseq | NM_001102406 |
| Protein Refseq | NP_001095876 |
| MIM | 607347 |
| UniProt ID | Q96QP1 |
| ◆ Recombinant Proteins | ||
| ALPK1-2177H | Recombinant Human ALPK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ALPK1-491H | Recombinant Human ALPK1 Protein, GST-tagged | +Inquiry |
| ALPK1-394HFL | Recombinant Full Length Human ALPK1 Protein, C-Flag-tagged | +Inquiry |
| ALPK1-3097H | Recombinant Human ALPK1 protein, His-tagged | +Inquiry |
| ALPK1-5985H | Recombinant Human ALPK1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALPK1-8894HCL | Recombinant Human ALPK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPK1 Products
Required fields are marked with *
My Review for All ALPK1 Products
Required fields are marked with *
