Recombinant Human AMD1 protein, GST-tagged
Cat.No. : | AMD1-7543H |
Product Overview : | Recombinant Human AMD1 protein(149-334 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 149-334 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS |
Gene Name | AMD1 adenosylmethionine decarboxylase 1 [ Homo sapiens ] |
Official Symbol | AMD1 |
Synonyms | AMD1; adenosylmethionine decarboxylase 1; S adenosylmethionine decarboxylase 1; S-adenosylmethionine decarboxylase proenzyme; SAMDC; S-adenosylmethionine decarboxylase 1; AMD; ADOMETDC; FLJ26964; DKFZp313L1234; |
Gene ID | 262 |
mRNA Refseq | NM_001033059 |
Protein Refseq | NP_001028231 |
MIM | 180980 |
UniProt ID | P17707 |
◆ Recombinant Proteins | ||
AMD1-130H | Recombinant Human AMD1 Protein, His-tagged | +Inquiry |
AMD1-7543H | Recombinant Human AMD1 protein, GST-tagged | +Inquiry |
AMD1-2483H | Recombinant Human Adenosylmethionine Decarboxylase 1, His-tagged | +Inquiry |
AMD1-577H | Recombinant Human Adenosylmethionine Decarboxylase 1, T7-tagged | +Inquiry |
AMD1-122H | Recombinant Human AMD1 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMD1-8886HCL | Recombinant Human AMD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMD1 Products
Required fields are marked with *
My Review for All AMD1 Products
Required fields are marked with *
0
Inquiry Basket