Recombinant Human AMELX protein, GST-tagged

Cat.No. : AMELX-519H
Product Overview : Human AMELX full-length ORF ( NP_001133.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 48 kDa
AA Sequence : MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMELX amelogenin, X-linked [ Homo sapiens ]
Official Symbol AMELX
Synonyms AMELX; amelogenin, X-linked; AIH1, amelogenin (X chromosome, amelogenesis imperfecta 1) , AMG; amelogenin, X isoform; amelogenesis imperfecta 1; amelogenin (amelogenesis imperfecta 1, X-linked); amelogenin (X chromosome, amelogenesis imperfecta 1); AMG; AI1E; AIH1; ALGN; AMGL; AMGX;
Gene ID 265
mRNA Refseq NM_001142
Protein Refseq NP_001133
MIM 300391
UniProt ID Q99217

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMELX Products

Required fields are marked with *

My Review for All AMELX Products

Required fields are marked with *

0
cart-icon
0
compare icon