Recombinant Human AMELX protein, GST-tagged
| Cat.No. : | AMELX-519H | 
| Product Overview : | Human AMELX full-length ORF ( NP_001133.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 48 kDa | 
| AA Sequence : | MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | AMELX amelogenin, X-linked [ Homo sapiens ] | 
| Official Symbol | AMELX | 
| Synonyms | AMELX; amelogenin, X-linked; AIH1, amelogenin (X chromosome, amelogenesis imperfecta 1) , AMG; amelogenin, X isoform; amelogenesis imperfecta 1; amelogenin (amelogenesis imperfecta 1, X-linked); amelogenin (X chromosome, amelogenesis imperfecta 1); AMG; AI1E; AIH1; ALGN; AMGL; AMGX; | 
| Gene ID | 265 | 
| mRNA Refseq | NM_001142 | 
| Protein Refseq | NP_001133 | 
| MIM | 300391 | 
| UniProt ID | Q99217 | 
| ◆ Recombinant Proteins | ||
| AMELX-519H | Recombinant Human AMELX protein, GST-tagged | +Inquiry | 
| AMELX-7078H | Recombinant Human AMELX, His&SUMO-tagged | +Inquiry | 
| Amelx-3407R | Recombinant Rat Amelx, His-tagged | +Inquiry | 
| AMELX-1026HF | Recombinant Full Length Human AMELX Protein, GST-tagged | +Inquiry | 
| AMELX-305R | Recombinant Rat AMELX Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| AMELX-70HCL | Recombinant Human AMELX cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All AMELX Products
Required fields are marked with *
My Review for All AMELX Products
Required fields are marked with *
  
        
    
      
            