Recombinant Human AMELX protein, GST-tagged
Cat.No. : | AMELX-519H |
Product Overview : | Human AMELX full-length ORF ( NP_001133.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 48 kDa |
AA Sequence : | MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMELX amelogenin, X-linked [ Homo sapiens ] |
Official Symbol | AMELX |
Synonyms | AMELX; amelogenin, X-linked; AIH1, amelogenin (X chromosome, amelogenesis imperfecta 1) , AMG; amelogenin, X isoform; amelogenesis imperfecta 1; amelogenin (amelogenesis imperfecta 1, X-linked); amelogenin (X chromosome, amelogenesis imperfecta 1); AMG; AI1E; AIH1; ALGN; AMGL; AMGX; |
Gene ID | 265 |
mRNA Refseq | NM_001142 |
Protein Refseq | NP_001133 |
MIM | 300391 |
UniProt ID | Q99217 |
◆ Recombinant Proteins | ||
AMELX-7078H | Recombinant Human AMELX, His&SUMO-tagged | +Inquiry |
Amelx-3407R | Recombinant Rat Amelx, His-tagged | +Inquiry |
AMELX-7079H | Recombinant Human AMELX, His-tagged | +Inquiry |
AMELX-7077H | Recombinant Human AMELX, His-tagged | +Inquiry |
AMELX-015H | Recombinant Human AMELX Protein, (AFPn)-His-TEV-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMELX-70HCL | Recombinant Human AMELX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMELX Products
Required fields are marked with *
My Review for All AMELX Products
Required fields are marked with *