Recombinant Human AMFR protein, GST-tagged
| Cat.No. : | AMFR-520H |
| Product Overview : | Human AMFR partial ORF ( NP_001135, 451 a.a. - 550 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This locus encodes a glycosylated transmembrane receptor. Its ligand, autocrine motility factor, is a tumor motility-stimulating protein secreted by tumor cells. The encoded receptor is also a member of the E3 ubiquitin ligase family of proteins. It catalyzes ubiquitination and endoplasmic reticulum-associated degradation of specific proteins. [provided by RefSeq, Feb 2012] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | QASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AMFR autocrine motility factor receptor, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | AMFR |
| Synonyms | AMFR; autocrine motility factor receptor, E3 ubiquitin protein ligase; autocrine motility factor receptor; gp78; RNF45; RING finger protein 45; GP78; |
| Gene ID | 267 |
| mRNA Refseq | NM_001144 |
| Protein Refseq | NP_001135 |
| MIM | 603243 |
| UniProt ID | P26442 |
| ◆ Recombinant Proteins | ||
| AMFR-856H | Recombinant Human AMFR protein, hFc-tagged | +Inquiry |
| AMFR-3783H | Recombinant Human AMFR, GST-tagged | +Inquiry |
| RFL22538HF | Recombinant Full Length Human E3 Ubiquitin-Protein Ligase Amfr(Amfr) Protein, His-Tagged | +Inquiry |
| AMFR-7854H | Recombinant Human AMFR protein, His-tagged | +Inquiry |
| RFL32124MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Amfr(Amfr) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMFR Products
Required fields are marked with *
My Review for All AMFR Products
Required fields are marked with *
