Recombinant Human AMFR protein, GST-tagged

Cat.No. : AMFR-520H
Product Overview : Human AMFR partial ORF ( NP_001135, 451 a.a. - 550 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This locus encodes a glycosylated transmembrane receptor. Its ligand, autocrine motility factor, is a tumor motility-stimulating protein secreted by tumor cells. The encoded receptor is also a member of the E3 ubiquitin ligase family of proteins. It catalyzes ubiquitination and endoplasmic reticulum-associated degradation of specific proteins. [provided by RefSeq, Feb 2012]
Molecular Mass : 36.74 kDa
AA Sequence : QASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMFR autocrine motility factor receptor, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol AMFR
Synonyms AMFR; autocrine motility factor receptor, E3 ubiquitin protein ligase; autocrine motility factor receptor; gp78; RNF45; RING finger protein 45; GP78;
Gene ID 267
mRNA Refseq NM_001144
Protein Refseq NP_001135
MIM 603243
UniProt ID P26442

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMFR Products

Required fields are marked with *

My Review for All AMFR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon