Recombinant Human AMFR protein, GST-tagged

• Cat.No.: AMFR-520H
• Product Overview: Human AMFR partial ORF ( NP_001135, 451 a.a. - 550 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This locus encodes a glycosylated transmembrane receptor. Its ligand, autocrine motility factor, is a tumor motility-stimulating protein secreted by tumor cells. The encoded receptor is also a member of the E3 ubiquitin ligase family of proteins. It catalyzes ubiquitination and endoplasmic reticulum-associated degradation of specific proteins. [provided by RefSeq, Feb 2012]
• Molecular Mass: 36.74 kDa
• AA Sequence: QASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AMFR autocrine motility factor receptor, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: AMFR
• Synonyms: AMFR; autocrine motility factor receptor, E3 ubiquitin protein ligase; autocrine motility factor receptor; gp78; RNF45; RING finger protein 45; GP78
• Gene ID: 267
• mRNA Refseq: NM_001144
• Protein Refseq: NP_001135
• MIM: 603243
• UniProt ID: P26442