Recombinant Human AMIGO2, His-tagged
Cat.No. : | AMIGO2-28H |
Product Overview : | Recombinant Human Amphoterin-Induced Protein 2/AMIGO2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Val40-His393) of Human AMIGO2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 40-393 a.a. |
Description : | Amphoterin-Induced Protein 2 (AMIGO2) is a single-pass type I membrane protein which belongs to the AMIGO family of immunoglobulin superfamily. Mature AMIGO2 contains an Ig-like C2-type (immunoglobulin-like) domain, 6 LRR (leucine-rich) repeats, a LRRCT domain, as well as a LRRNT domain. AMIGO2 is mainly expressed in in breast, ovary, cervix, and uterus, although lower in lung, colon, and rectum. AMIGO2 required for depolarization-dependent survival of cultured cerebellar granule neurons. AMIGO2 may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. AMIGO2 may contribute to signal transduction through its intracellular domain, and may be required for tumorigenesis of a subset of gastric adenocarcinomas. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | VCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNN ITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQK LYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDC SLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHE AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCI AMNKQRLLNETVDVTINVSNFTVSRSHAHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | AMIGO2 adhesion molecule with Ig-like domain 2 [ Homo sapiens ] |
Official Symbol | AMIGO2 |
Synonyms | AMIGO2; adhesion molecule with Ig-like domain 2; amphoterin-induced protein 2; ALI1; amphoterin induced gene and open reading frame 2; DEGA; alivin 1; amphoterin induced gene 2; transmembrane protein AMIGO2; differentially expressed in gastric adenocarcinoma; differentially expressed in gastric adenocarcinomas; AMIGO-2; |
Gene ID | 347902 |
mRNA Refseq | NM_181847 |
Protein Refseq | NP_862830 |
UniProt ID | Q86SJ2 |
Chromosome Location | 12q13.11 |
◆ Recombinant Proteins | ||
AMIGO2-28H | Recombinant Human AMIGO2, His-tagged | +Inquiry |
AMIGO2-1669C | Recombinant Cynomolgus AMIGO2 protein, His-tagged | +Inquiry |
AMIGO2-653R | Recombinant Rat AMIGO2 Protein | +Inquiry |
AMIGO2-0018H | Recombinant Human AMIGO2 Protein (Thr30-Ala399), N-His-tagged | +Inquiry |
AMIGO2-524H | Recombinant Human AMIGO2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMIGO2-1147HCL | Recombinant Human AMIGO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMIGO2 Products
Required fields are marked with *
My Review for All AMIGO2 Products
Required fields are marked with *
0
Inquiry Basket