Recombinant Human AMIGO2, His-tagged

• Cat.No.: AMIGO2-28H
• Product Overview: Recombinant Human Amphoterin-Induced Protein 2/AMIGO2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Val40-His393) of Human AMIGO2 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 40-393 a.a.
• Description: Amphoterin-Induced Protein 2 (AMIGO2) is a single-pass type I membrane protein which belongs to the AMIGO family of immunoglobulin superfamily. Mature AMIGO2 contains an Ig-like C2-type (immunoglobulin-like) domain, 6 LRR (leucine-rich) repeats, a LRRCT domain, as well as a LRRNT domain. AMIGO2 is mainly expressed in in breast, ovary, cervix, and uterus, although lower in lung, colon, and rectum. AMIGO2 required for depolarization-dependent survival of cultured cerebellar granule neurons. AMIGO2 may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. AMIGO2 may contribute to signal transduction through its intracellular domain, and may be required for tumorigenesis of a subset of gastric adenocarcinomas.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: VCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNN ITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQK LYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDC SLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHE AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCI AMNKQRLLNETVDVTINVSNFTVSRSHAHVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: AMIGO2 adhesion molecule with Ig-like domain 2 [ Homo sapiens ]
• Official Symbol: AMIGO2
• Synonyms: AMIGO2; adhesion molecule with Ig-like domain 2; amphoterin-induced protein 2; ALI1; amphoterin induced gene and open reading frame 2; DEGA; alivin 1; amphoterin induced gene 2; transmembrane protein AMIGO2; differentially expressed in gastric adenocarcinoma; differentially expressed in gastric adenocarcinomas; AMIGO-2
• Gene ID: 347902
• mRNA Refseq: NM_181847
• Protein Refseq: NP_862830
• UniProt ID: Q86SJ2
• Chromosome Location: 12q13.11