Recombinant Human AMIGO2, His-tagged

Cat.No. : AMIGO2-28H
Product Overview : Recombinant Human Amphoterin-Induced Protein 2/AMIGO2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Val40-His393) of Human AMIGO2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 40-393 a.a.
Description : Amphoterin-Induced Protein 2 (AMIGO2) is a single-pass type I membrane protein which belongs to the AMIGO family of immunoglobulin superfamily. Mature AMIGO2 contains an Ig-like C2-type (immunoglobulin-like) domain, 6 LRR (leucine-rich) repeats, a LRRCT domain, as well as a LRRNT domain. AMIGO2 is mainly expressed in in breast, ovary, cervix, and uterus, although lower in lung, colon, and rectum. AMIGO2 required for depolarization-dependent survival of cultured cerebellar granule neurons. AMIGO2 may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. AMIGO2 may contribute to signal transduction through its intracellular domain, and may be required for tumorigenesis of a subset of gastric adenocarcinomas.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : VCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNN ITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQK LYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDC SLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHE AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCI AMNKQRLLNETVDVTINVSNFTVSRSHAHVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name AMIGO2 adhesion molecule with Ig-like domain 2 [ Homo sapiens ]
Official Symbol AMIGO2
Synonyms AMIGO2; adhesion molecule with Ig-like domain 2; amphoterin-induced protein 2; ALI1; amphoterin induced gene and open reading frame 2; DEGA; alivin 1; amphoterin induced gene 2; transmembrane protein AMIGO2; differentially expressed in gastric adenocarcinoma; differentially expressed in gastric adenocarcinomas; AMIGO-2;
Gene ID 347902
mRNA Refseq NM_181847
Protein Refseq NP_862830
UniProt ID Q86SJ2
Chromosome Location 12q13.11

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMIGO2 Products

Required fields are marked with *

My Review for All AMIGO2 Products

Required fields are marked with *

0
cart-icon