Recombinant Human AMMECR1 protein, GST-tagged
| Cat.No. : | AMMECR1-526H |
| Product Overview : | Human AMMECR1 full-length ORF ( NP_001020751.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
| Molecular Mass : | 57.7 kDa |
| AA Sequence : | MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 [ Homo sapiens ] |
| Official Symbol | AMMECR1 |
| Synonyms | AMMECR1; Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1; AMME syndrome candidate gene 1 protein; AMMERC1; |
| Gene ID | 9949 |
| mRNA Refseq | NM_001025580 |
| Protein Refseq | NP_001020751 |
| MIM | 300195 |
| UniProt ID | Q9Y4X0 |
| ◆ Recombinant Proteins | ||
| AMMECR1-9620H | Recombinant Human AMMECR1, His-tagged | +Inquiry |
| AMMECR1-10859Z | Recombinant Zebrafish AMMECR1 | +Inquiry |
| AMMECR1-1096HF | Recombinant Full Length Human AMMECR1 Protein, GST-tagged | +Inquiry |
| AMMECR1-151H | Recombinant Human AMMECR1 Protein, His-tagged | +Inquiry |
| Ammecr1-1611M | Recombinant Mouse Ammecr1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMMECR1-8880HCL | Recombinant Human AMMECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMMECR1 Products
Required fields are marked with *
My Review for All AMMECR1 Products
Required fields are marked with *



