Recombinant Human AMMECR1 protein, GST-tagged
Cat.No. : | AMMECR1-526H |
Product Overview : | Human AMMECR1 full-length ORF ( NP_001020751.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMMECR1 Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 [ Homo sapiens ] |
Official Symbol | AMMECR1 |
Synonyms | AMMECR1; Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1; AMME syndrome candidate gene 1 protein; AMMERC1; |
Gene ID | 9949 |
mRNA Refseq | NM_001025580 |
Protein Refseq | NP_001020751 |
MIM | 300195 |
UniProt ID | Q9Y4X0 |
◆ Recombinant Proteins | ||
AMMECR1-10859Z | Recombinant Zebrafish AMMECR1 | +Inquiry |
Ammecr1-1611M | Recombinant Mouse Ammecr1 Protein, Myc/DDK-tagged | +Inquiry |
AMMECR1-9620H | Recombinant Human AMMECR1, His-tagged | +Inquiry |
AMMECR1-1096HF | Recombinant Full Length Human AMMECR1 Protein, GST-tagged | +Inquiry |
AMMECR1-151H | Recombinant Human AMMECR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMMECR1-8880HCL | Recombinant Human AMMECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMMECR1 Products
Required fields are marked with *
My Review for All AMMECR1 Products
Required fields are marked with *
0
Inquiry Basket