Recombinant Human AMN1 protein, GST-tagged
Cat.No. : | AMN1-527H |
Product Overview : | Human AMN1 full-length ORF ( NP_997220.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AMN1 (Antagonist Of Mitotic Exit Network 1 Homolog) is a Protein Coding gene. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMN1 antagonist of mitotic exit network 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | AMN1 |
Synonyms | AMN1; antagonist of mitotic exit network 1 homolog (S. cerevisiae); protein AMN1 homolog; |
Gene ID | 196394 |
mRNA Refseq | NM_001113402 |
Protein Refseq | NP_001106873 |
UniProt ID | Q8IY45 |
◆ Recombinant Proteins | ||
AMN1-655R | Recombinant Rat AMN1 Protein | +Inquiry |
AMN1-9621H | Recombinant Human AMN1, GST-tagged | +Inquiry |
AMN1-7854H | Recombinant Human AMN1 protein, His-tagged | +Inquiry |
AMN1-311R | Recombinant Rat AMN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMN1-1380HF | Recombinant Full Length Human AMN1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMN1 Products
Required fields are marked with *
My Review for All AMN1 Products
Required fields are marked with *