Recombinant Human AMN1 protein, GST-tagged

Cat.No. : AMN1-527H
Product Overview : Human AMN1 full-length ORF ( NP_997220.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AMN1 (Antagonist Of Mitotic Exit Network 1 Homolog) is a Protein Coding gene.
Molecular Mass : 49.4 kDa
AA Sequence : MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMN1 antagonist of mitotic exit network 1 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol AMN1
Synonyms AMN1; antagonist of mitotic exit network 1 homolog (S. cerevisiae); protein AMN1 homolog;
Gene ID 196394
mRNA Refseq NM_001113402
Protein Refseq NP_001106873
UniProt ID Q8IY45

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMN1 Products

Required fields are marked with *

My Review for All AMN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon