Recombinant Human AMPD2
Cat.No. : | AMPD2-27197TH |
Product Overview : | Recombinant fragment of Human AMPD2, isoform Ex1A-2-3 with N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Three isoforms are present in mammals: AMP deaminase 1 is the predominant form in skeletal muscle; AMP deaminase 2 predominates in smooth muscle, non-muscle tissue, embryonic muscle and undifferentiated myoblasts; AMP deaminase 3 is found in erythrocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT |
Sequence Similarities : | Belongs to the adenosine and AMP deaminases family. |
Gene Name | AMPD2 adenosine monophosphate deaminase 2 [ Homo sapiens ] |
Official Symbol | AMPD2 |
Synonyms | AMPD2; adenosine monophosphate deaminase 2; adenosine monophosphate deaminase 2 (isoform L); AMP deaminase 2; AMPD isoform L; |
Gene ID | 271 |
mRNA Refseq | NM_004037 |
Protein Refseq | NP_004028 |
MIM | 102771 |
Uniprot ID | Q01433 |
Chromosome Location | 1p13.3 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, organism-specific biosystem; |
Function | AMP deaminase activity; hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
AMPD2-27197TH | Recombinant Human AMPD2 | +Inquiry |
AMPD2-1607M | Recombinant Mouse AMPD2 Protein | +Inquiry |
AMPD2-143H | Recombinant Human AMPD2 Protein, His-tagged | +Inquiry |
AMPD2-530H | Recombinant Human AMPD2 protein, GST-tagged | +Inquiry |
Ampd2-144M | Recombinant Mouse Ampd2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMPD2-8876HCL | Recombinant Human AMPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMPD2 Products
Required fields are marked with *
My Review for All AMPD2 Products
Required fields are marked with *
0
Inquiry Basket