Recombinant Human AMT protein, His-tagged
| Cat.No. : | AMT-2690H |
| Product Overview : | Recombinant Human AMT protein(147-321 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 147-321 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | EKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLM |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AMT aminomethyltransferase [ Homo sapiens ] |
| Official Symbol | AMT |
| Synonyms | AMT; aminomethyltransferase; aminomethyltransferase (glycine cleavage system protein T); aminomethyltransferase, mitochondrial; GCST; glycine cleavage system protein T; NKH; glycine cleavage system T protein; GCE; GCVT; |
| Gene ID | 275 |
| mRNA Refseq | NM_000481 |
| Protein Refseq | NP_000472 |
| MIM | 238310 |
| UniProt ID | P48728 |
| ◆ Recombinant Proteins | ||
| AMT-6744H | Recombinant Human AMT protein, GST-tagged | +Inquiry |
| AMT-1538Z | Recombinant Zebrafish AMT | +Inquiry |
| AMT-6351C | Recombinant Chicken AMT | +Inquiry |
| AMT-45C | Recombinant Cynomolgus Monkey AMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| AMT-1985H | Recombinant Human AMT Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMT-72HCL | Recombinant Human AMT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMT Products
Required fields are marked with *
My Review for All AMT Products
Required fields are marked with *
