Recombinant Human AMY2A protein, GST-tagged

Cat.No. : AMY2A-535H
Product Overview : Human AMY2A full-length ORF ( NP_000690.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the alpha-amylase family of proteins. Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, catalyzing the first step in digestion of dietary starch and glycogen. This gene and several family members are present in a gene cluster on chromosome 1. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jan 2015]
Molecular Mass : 84.1 kDa
AA Sequence : MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMY2A amylase, alpha 2A (pancreatic) [ Homo sapiens ]
Official Symbol AMY2A
Synonyms AMY2A; amylase, alpha 2A (pancreatic); AMY2, amylase, alpha 2A; pancreatic; pancreatic alpha-amylase; glycogenase; alpha-amylase; found in the pancreas; pancreatic amylase 2A; pancreatic amylase alpha 2A; amylase, pancreatic, alpha-2A; 1,4-alpha-D-glucan glucanohydrolase; PA; AMY2; AMY2B;
Gene ID 279
mRNA Refseq NM_000699
Protein Refseq NP_000690
MIM 104650
UniProt ID P04746

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMY2A Products

Required fields are marked with *

My Review for All AMY2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon