Recombinant Human AMY2A protein, GST-tagged
Cat.No. : | AMY2A-535H |
Product Overview : | Human AMY2A full-length ORF ( NP_000690.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the alpha-amylase family of proteins. Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, catalyzing the first step in digestion of dietary starch and glycogen. This gene and several family members are present in a gene cluster on chromosome 1. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jan 2015] |
Molecular Mass : | 84.1 kDa |
AA Sequence : | MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMY2A amylase, alpha 2A (pancreatic) [ Homo sapiens ] |
Official Symbol | AMY2A |
Synonyms | AMY2A; amylase, alpha 2A (pancreatic); AMY2, amylase, alpha 2A; pancreatic; pancreatic alpha-amylase; glycogenase; alpha-amylase; found in the pancreas; pancreatic amylase 2A; pancreatic amylase alpha 2A; amylase, pancreatic, alpha-2A; 1,4-alpha-D-glucan glucanohydrolase; PA; AMY2; AMY2B; |
Gene ID | 279 |
mRNA Refseq | NM_000699 |
Protein Refseq | NP_000690 |
MIM | 104650 |
UniProt ID | P04746 |
◆ Recombinant Proteins | ||
AMY2A-538R | Recombinant Rhesus AMY2A protein, His-tagged | +Inquiry |
AMY2A-56C | Recombinant Cynomolgus AMY2A, His tagged | +Inquiry |
AMY2A-12252Z | Recombinant Zebrafish AMY2A | +Inquiry |
AMY2A-194C | Recombinant Cynomolgus AMY2A, Fc-tagged | +Inquiry |
AMY2A-535H | Recombinant Human AMY2A protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AMY2A-8353H | Native Human AMY2A | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMY2A-1351HCL | Recombinant Human AMY2A cell lysate | +Inquiry |
AMY2A-001CCL | Recombinant Cynomolgus AMY2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMY2A Products
Required fields are marked with *
My Review for All AMY2A Products
Required fields are marked with *