Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human Amyloid-Beta 1-40 Protein, E22G, 15N Label

Cat.No. : ABN-302H
Product Overview : Recombinant Human Amyloid-Beta 1-40 Protein, Glu22Gly, 15N Uniform Label (Artic variant) is expressed in Escherichia coli in minimal media using 15NH4Cl as sole nitrogen source. Counter Ion: Ammonium Acetate.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Form : Lyophilized
AA Sequence : DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Purity : > 95% HPLC and SDS-PAGE
Storage : Store at -20 centigrade upon arrival.
Reconstitution : It is importance to follow our recommendations of solubilisation and to efficiently solubilise the Amyloid β-peptide the pH should briefly be raised to between 11-12. This can be accomplished by addition of e.g. 20 mM NaOH, however, at higher peptide concentrations a higher concentration of NaOH may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using a 10X stock solution of the buffer of choice.

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All ABN Products

Required fields are marked with *

My Review for All ABN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends