Recombinant Human Amyloid-Beta 1-40 Protein, E22G, 15N Label
Cat.No. : | ABN-302H |
Product Overview : | Recombinant Human Amyloid-Beta 1-40 Protein, Glu22Gly, 15N Uniform Label (Artic variant) is expressed in Escherichia coli in minimal media using 15NH4Cl as sole nitrogen source. Counter Ion: Ammonium Acetate. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Form : | Lyophilized |
AA Sequence : | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV |
Purity : | > 95% HPLC and SDS-PAGE |
Storage : | Store at -20 centigrade upon arrival. |
Reconstitution : | It is importance to follow our recommendations of solubilisation and to efficiently solubilise the Amyloid β-peptide the pH should briefly be raised to between 11-12. This can be accomplished by addition of e.g. 20 mM NaOH, however, at higher peptide concentrations a higher concentration of NaOH may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using a 10X stock solution of the buffer of choice. |
Products Types
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ABN Products
Required fields are marked with *
My Review for All ABN Products
Required fields are marked with *
0
Inquiry Basket