"ANGPT4" Related Products

Expand
Expand

Recombinant Human ANGPT4 protein, GST-tagged

Cat.No. : ANGPT4-552H
Product Overview : Human ANGPT4 partial ORF ( NP_057069, 25 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 35.31 kDa
AA Sequence : TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Figure :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : ANGPT4 angiopoietin 4 [ Homo sapiens ]
Official Symbol : ANGPT4
Synonyms : ANGPT4; angiopoietin 4; angiopoietin-4; ANG-4; angiopoietin-3; dJ824F16.2 (angiopoietin 4); AGP4; ANG4; ANG-3; MGC138181; MGC138183;
Gene ID : 51378
mRNA Refseq : NM_015985
Protein Refseq : NP_057069
MIM : 603705
UniProt ID : Q9Y264

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.