Recombinant Human ANGPTL7 protein, GST-tagged
| Cat.No. : | ANGPTL7-560H |
| Product Overview : | Human ANGPTL7 full-length ORF ( AAH01881, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANGPTL7 (Angiopoietin Like 7) is a Protein Coding gene. An important paralog of this gene is ANGPT4. |
| Molecular Mass : | 63.8 kDa |
| AA Sequence : | MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANGPTL7 angiopoietin-like 7 [ Homo sapiens ] |
| Official Symbol | ANGPTL7 |
| Synonyms | ANGPTL7; angiopoietin-like 7; angiopoietin-related protein 7; AngX; CDT6; angiopoietin-like protein 7; angiopoietin-like factor (CDT6); cornea-derived transcript 6 protein; dJ647M16.1; RP4-647M16.2; |
| Gene ID | 10218 |
| mRNA Refseq | NM_021146 |
| Protein Refseq | NP_066969 |
| UniProt ID | O43827 |
| ◆ Recombinant Proteins | ||
| Angptl7-1574M | Recombinant Mouse Angptl7 protein, His-tagged | +Inquiry |
| ANGPTL7-166R | Recombinant Rhesus ANGPTL7 protein, His-tagged | +Inquiry |
| Angptl7-657M | Active Recombinant Mouse Angptl7, His-tagged | +Inquiry |
| Angptl7-555M | Active Recombinant Mouse Angiopoietin-Like 7, His-tagged | +Inquiry |
| ANGPTL7-327H | Recombinant Human ANGPTL7 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANGPTL7-769CCL | Recombinant Canine ANGPTL7 cell lysate | +Inquiry |
| ANGPTL7-766CCL | Recombinant Cynomolgus ANGPTL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL7 Products
Required fields are marked with *
My Review for All ANGPTL7 Products
Required fields are marked with *
