Recombinant Human ANGPTL8 Protein, His-tagged
| Cat.No. : | ANGPTL8-2078H |
| Product Overview : | Recombinant Human ANGPTL8 Protein(Q6UXH0)(22-198 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-198 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 23.9 kDa |
| AASequence : | APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
| Purity : | ≥ 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| ◆ Recombinant Proteins | ||
| ANGPTL8-01H | Active Recombinant Human ANGPTL8 Protein, His-tagged | +Inquiry |
| Angptl8-2333M | Recombinant Mouse Angptl8 protein, His-tagged | +Inquiry |
| ANGPTL8-3313H | Recombinant Human ANGPTL8 protein, His&Myc-tagged | +Inquiry |
| Angptl8-175M | Recombinant Mouse Angptl8 protein, His-tagged | +Inquiry |
| Angptl8-5916M | Recombinant Mouse Angptl8 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL8 Products
Required fields are marked with *
My Review for All ANGPTL8 Products
Required fields are marked with *
