Recombinant Human ANGPTL8 Protein, His-tagged

• Cat.No.: ANGPTL8-2078H
• Product Overview: Recombinant Human ANGPTL8 Protein (22-198 aa) with His tag was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-198 aa
• Description: Predicted to enable hormone activity. Involved in regulation of lipid metabolic process and triglyceride homeostasis. Acts upstream of or within positive regulation of protein processing and regulation of lipoprotein metabolic process. Located in extracellular region.
• Form: Sterile PBS, pH 8.0, 0.1% SKL
• Molecular Mass: 21 kDa
• AASequence: MAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPAGGGGSHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: ANGPTL8 angiopoietin like 8 [ Homo sapiens (human) ]
• Official Symbol: ANGPTL8
• Synonyms: ANGPTL8; angiopoietin like 8; RIFL; TD26; PRO1185; PVPA599; C19orf80; angiopoietin-like protein 8; hepatocellular carcinoma-associated gene TD26; hepatocellular carcinoma-associated protein TD26; lipasin; refeeding-induced fat and liver protein
• Gene ID: 55908
• mRNA Refseq: NM_018687
• Protein Refseq: NP_061157
• MIM: 616223
• UniProt ID: Q6UXH0