Recombinant Human ANK3 protein, His-tagged
Cat.No. : | ANK3-2873H |
Product Overview : | Recombinant Human ANK3 protein(3668 - 3870 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3668 - 3870 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | METNLERNVETPTVEPNPSIPTSGECQEGTSSSGSLEKSAAATNTSKVDPKLRTPIKMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETITMISNTANSQMGVRPHEKHDFQKDNFNNNNNLDSSTIQTDNIMSNIVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCVRDKQKVLGEQQKTKELIGIRQKSKLPIKAT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ANK3 ankyrin 3, node of Ranvier (ankyrin G) [ Homo sapiens ] |
Official Symbol | ANK3 |
Synonyms | ANK3; ankyrin 3, node of Ranvier (ankyrin G); ankyrin-3; ankyrin 3; node of Ranvier; ankyrin G; ankyrin G119; ANKYRIN-G; FLJ45464; |
Gene ID | 288 |
mRNA Refseq | NM_001149 |
Protein Refseq | NP_001140 |
MIM | 600465 |
UniProt ID | Q12955 |
◆ Recombinant Proteins | ||
ANK3-4719C | Recombinant Chicken ANK3 | +Inquiry |
ANK3-4633H | Recombinant Human ANK3 protein, hFc-tagged | +Inquiry |
ANK3-3181H | Recombinant Human ANK3 protein, His-tagged | +Inquiry |
ANK3-154H | Recombinant Human ANK3 Protein, His-tagged | +Inquiry |
ANK3-1789H | Recombinant Human ANK3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANK3 Products
Required fields are marked with *
My Review for All ANK3 Products
Required fields are marked with *
0
Inquiry Basket