Recombinant Human ANKRD16 protein, GST-tagged

• Cat.No.: ANKRD16-577H
• Product Overview: Human ANKRD16 full-length ORF ( NP_001009941.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD16 (Ankyrin Repeat Domain 16) is a Protein Coding gene. An important paralog of this gene is FEM1A.
• Molecular Mass: 65.7 kDa
• AA Sequence: MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD16 ankyrin repeat domain 16 [ Homo sapiens ]
• Official Symbol: ANKRD16
• Synonyms: ANKRD16; ankyrin repeat domain 16
• Gene ID: 54522
• mRNA Refseq: NM_019046.2
• Protein Refseq: NP_061919.1
• UniProt ID: Q6P6B7