Recombinant Human ANKRD16 protein, GST-tagged
Cat.No. : | ANKRD16-577H |
Product Overview : | Human ANKRD16 full-length ORF ( NP_001009941.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD16 (Ankyrin Repeat Domain 16) is a Protein Coding gene. An important paralog of this gene is FEM1A. |
Molecular Mass : | 65.7 kDa |
AA Sequence : | MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD16 ankyrin repeat domain 16 [ Homo sapiens ] |
Official Symbol | ANKRD16 |
Synonyms | ANKRD16; ankyrin repeat domain 16 |
Gene ID | 54522 |
mRNA Refseq | NM_019046.2 |
Protein Refseq | NP_061919.1 |
UniProt ID | Q6P6B7 |
◆ Recombinant Proteins | ||
ANKRD16-674R | Recombinant Rat ANKRD16 Protein | +Inquiry |
ANKRD16-1207HF | Recombinant Full Length Human ANKRD16 Protein, GST-tagged | +Inquiry |
Ankrd16-1631M | Recombinant Mouse Ankrd16 Protein, Myc/DDK-tagged | +Inquiry |
ANKRD16-245H | Recombinant Human ANKRD16 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANKRD16-330R | Recombinant Rat ANKRD16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD16-22HCL | Recombinant Human ANKRD16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD16 Products
Required fields are marked with *
My Review for All ANKRD16 Products
Required fields are marked with *