Recombinant Human ANKRD16 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ANKRD16-4378H |
| Product Overview : | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ANKRD16 (Ankyrin Repeat Domain 16) is a Protein Coding gene. An important paralog of this gene is ASB1. |
| Molecular Mass : | 35.3 kDa |
| AA Sequence : | MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ANKRD16 ankyrin repeat domain 16 [ Homo sapiens (human) ] |
| Official Symbol | ANKRD16 |
| Synonyms | ANKRD16; ankyrin repeat domain 16; ankyrin repeat domain-containing protein 16 |
| Gene ID | 54522 |
| mRNA Refseq | NM_001009942 |
| Protein Refseq | NP_001009942 |
| MIM | 618017 |
| UniProt ID | Q6P6B7 |
| ◆ Recombinant Proteins | ||
| ANKRD16-330R | Recombinant Rat ANKRD16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANKRD16-4260C | Recombinant Chicken ANKRD16 | +Inquiry |
| ANKRD16-245H | Recombinant Human ANKRD16 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ANKRD16-1657M | Recombinant Mouse ANKRD16 Protein | +Inquiry |
| Ankrd16-1631M | Recombinant Mouse Ankrd16 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANKRD16-22HCL | Recombinant Human ANKRD16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD16 Products
Required fields are marked with *
My Review for All ANKRD16 Products
Required fields are marked with *
