Recombinant Human ANKRD36 protein, GST-tagged
Cat.No. : | ANKRD36-592H |
Product Overview : | Human ANKRD36 full-length ORF ( NP_940957.3, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD36 (Ankyrin Repeat Domain 36) is a Protein Coding gene. An important paralog of this gene is ANKRD36C. |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MEDGKRERWPTLMERLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD36 ankyrin repeat domain 36 [ Homo sapiens (human) ] |
Official Symbol | ANKRD36 |
Synonyms | ANKRD36; ankyrin repeat domain 36; UNQ2430; ankyrin repeat domain-containing protein 36A; ankyrin repeat domain-containing protein 36; ankyrin-related |
Gene ID | 375248 |
mRNA Refseq | NM_001164315 |
Protein Refseq | NP_001157787 |
UniProt ID | A6QL64 |
◆ Recombinant Proteins | ||
ANKRD36-592H | Recombinant Human ANKRD36 protein, GST-tagged | +Inquiry |
ANKRD36-1311HF | Recombinant Full Length Human ANKRD36 Protein, GST-tagged | +Inquiry |
ANKRD36-3482H | Recombinant Human ANKRD36, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD36-25HCL | Recombinant Human ANKRD36 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD36 Products
Required fields are marked with *
My Review for All ANKRD36 Products
Required fields are marked with *