Recombinant Human ANKRD36 protein, GST-tagged

• Cat.No.: ANKRD36-592H
• Product Overview: Human ANKRD36 full-length ORF ( NP_940957.3, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD36 (Ankyrin Repeat Domain 36) is a Protein Coding gene. An important paralog of this gene is ANKRD36C.
• Molecular Mass: 45.3 kDa
• AA Sequence: MEDGKRERWPTLMERLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD36 ankyrin repeat domain 36 [ Homo sapiens (human) ]
• Official Symbol: ANKRD36
• Synonyms: ANKRD36; ankyrin repeat domain 36; UNQ2430; ankyrin repeat domain-containing protein 36A; ankyrin repeat domain-containing protein 36; ankyrin-related
• Gene ID: 375248
• mRNA Refseq: NM_001164315
• Protein Refseq: NP_001157787
• UniProt ID: A6QL64