Recombinant Human ANKRD36 protein, GST-tagged
| Cat.No. : | ANKRD36-592H |
| Product Overview : | Human ANKRD36 full-length ORF ( NP_940957.3, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANKRD36 (Ankyrin Repeat Domain 36) is a Protein Coding gene. An important paralog of this gene is ANKRD36C. |
| Molecular Mass : | 45.3 kDa |
| AA Sequence : | MEDGKRERWPTLMERLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD36 ankyrin repeat domain 36 [ Homo sapiens (human) ] |
| Official Symbol | ANKRD36 |
| Synonyms | ANKRD36; ankyrin repeat domain 36; UNQ2430; ankyrin repeat domain-containing protein 36A; ankyrin repeat domain-containing protein 36; ankyrin-related |
| Gene ID | 375248 |
| mRNA Refseq | NM_001164315 |
| Protein Refseq | NP_001157787 |
| UniProt ID | A6QL64 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD36 Products
Required fields are marked with *
My Review for All ANKRD36 Products
Required fields are marked with *



