Recombinant Human ANKRD36B protein, GST-tagged
| Cat.No. : | ANKRD36B-593H |
| Product Overview : | Human ANKRD36B full-length ORF ( AAH71771.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANKRD36B (Ankyrin Repeat Domain 36B) is a Protein Coding gene. An important paralog of this gene is ANKRD36C. |
| Molecular Mass : | 53.7 kDa |
| AA Sequence : | MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNAIDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVVSSETTS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD36B ankyrin repeat domain 36B [ Homo sapiens (human) ] |
| Official Symbol | ANKRD36B |
| Synonyms | ANKRD36B; ankyrin repeat domain 36B; KIAA1641; ankyrin repeat domain-containing protein 36B; CLL-associated antigen KW-1; melanoma-associated antigen |
| Gene ID | 57730 |
| mRNA Refseq | NM_025190 |
| Protein Refseq | NP_079466 |
| UniProt ID | Q8N2N9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD36B Products
Required fields are marked with *
My Review for All ANKRD36B Products
Required fields are marked with *



